$Id: Tutorial.rd,v 1.2 2005/08/31 13:16:03 ngoto Exp $

Copyright (C) 2001-2003 KATAYAMA Toshiaki <k@bioruby.org>

Translated into English: Naohisa Goto <ng@bioruby.org>
                         (to be written...)

How to use BioRuby

Manipulating nucleic / amino acid sequences (Bio::Sequence class)

For simple example, by using a short DNA seuquence "atgcatgcaaaa", we are now converting into complemental strand, splicing subsequence, calculating nucleic acid compositions, translating to amino acid sequence, calculating molecular weight, and so on. About translation to amino acid sequences, you can specify frame where you want to start translation from and condon table ID defined in codontable.rb.

#!/usr/bin/env ruby

require 'bio'

seq = Bio::Sequence::NA.new("atgcatgcaaaa")

puts seq                            # original sequence
puts seq.complement                 # complemental sequence (Bio::Sequence::NA object)
puts seq.subseq(3,8)                # gets subsequence of positions 3 to 8

p seq.gc_percent                    # GC percent (Float)
p seq.composition                   # nucleic acid compositions (Hash)

puts seq.translate                  # translation (Bio::Sequence::AA object)
puts seq.translate(2)               # translation from frame 2 (default is frame 1)
puts seq.translate(1,11)            # using codon table No.11 (TRANSLATOR'S NOTE: codon tables are showed at http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi )

p seq.translate.codes               # shows three-letter codes (Array)
p seq.translate.names               # shows amino acid names (Array)
p seq.translate.composition         # amino acid compositions (Hash)
p seq.translate.molecular_weight    # calculating molecular weight (Float)

puts seq.complement.translate       # translation of complemental strand

Nucleic acid sequence is an object of Bio::Sequence::NA class, and amino acid sequenc is an object of Bio::Sequence::AA class. Because both classes inherit Bio::Sequence class, most methods are common.

As Bio::Sequence class inherits Ruby's String class, you can use methods of String class. For example, to get subsequence, you can use not only subseq(from, to) method but also String#[] method. Please be careful that positions of Ruby's string begin with 0 for first letter. When you use String's methods, you should subtract 1 from positions conventionally used in biology. (subseq method returns nil if you specify positions smaller than or equeal to 0 for either one of the "from" or "to".) (TRANSLATOR'S NOTE: the text in Japanese is something wrong?)

The window_search(window_size, step_size) method passes each subsequence to the supplied block for each sliding window specified by parameters. Since the class of each subsequence is the same as original sequence (Bio::Sequence::NA or Bio::Seuence::AA or Bio::Sequence), you can use all methods in the class. For example,

You can specify stepping size with the second argument.

Moreover, the window_search method returns leftover subsequence in the end of the sequence shorter than stepping size. By using it, you can easily do such as:

If you want non-overlapping window, you shall specify same length to window size and stepping size.

In most cases, sequences are read from files or retrieved from databases. For example:

#!/usr/bin/env ruby

require 'bio'

input_seq = ARGF.read       # reads all files in arguments

my_naseq = Bio::Sequence::NA.new(input_seq)
my_aaseq = my_naseq.translate

puts my_aaseq

We saves the program as na2aa.rb. We also prepare a nucleic acid sequence described below and saves it as my_naseq.txt.

gtggcgatctttccgaaagcgatgactggagcgaagaaccaaagcagtgacatttgtctg
atgccgcacgtaggcctgataagacgcggacagcgtcgcatcaggcatcttgtgcaaatg
tcggatgcggcgtga

na2aa.rb translates a nucleic acid sequence to a protein sequence. For example, translates my_naseq.txt: (TRANSLATOR'S NOTE: don't forget "chmod +x na2aa.rb")

% ./na2aa.rb my_naseq.txt
VAIFPKAMTGAKNQSSDICLMPHVGLIRRGQRRIRHLVQMSDAA*

You can also write it as a one-liner script.

% ruby -r bio -e 'p Bio::Sequence::NA.new($<.read).translate' my_naseq.txt

In the next section, we are going to retrieve data from databases instead of using raw sequence files.

Parsing GenBank data (Bio::GenBank class)

We assume that you already have some GenBank data files. (If you don't have, you shall download any *.seq files from ftp://ftp.ncbi.nih.gov/genbank/ .) Now, let's get ID, definition and sequence of each entry form the file. Like gb2fasta command, sequences are displayed as FASTA format text. Note that the "DELIMITER" used in below scrpit is a constant defined in GenBank class and means delimiter string of the database. For example, "//" for GenBank class. By using DELIMITER, you don't need to remember each database's delimiter string different from each other. In addition, the name RS (record separator) is an alias of DELIMITER. (TRANSLATOR'S NOTE: gb2fasta command converts GenBank files to FASTA format files. It have been independently developed in many places. It is also included as a sample script in BioRuby.) (TRANSLATOR'S NOTE: The script below is historical and not recommended now.)

#!/usr/bin/env ruby

require 'bio'

while entry = gets(Bio::GenBank::DELIMITER)
  gb = Bio::GenBank.new(entry)      # creates GenBank object

  print ">#{gb.accession} "         # Accession
  puts gb.definition                # Definition
  puts gb.naseq                     # Nucleic acid sequence (Bio::Sequence::NA object)
end

Now, using Bio::FlatFile is recommended. You can rewrite above script as:

#!/usr/bin/env ruby

require 'bio'

ff = Bio::FlatFile.new(Bio::GenBank, ARGF)
ff.each_entry do |gb|
  definition = "#{gb.accession} #{gb.definition}"
  puts gb.naseq.to_fasta(definition, 60)    
end

On the other hand, reading FASTA format seuqnece files as follows:

#!/usr/bin/env ruby

require 'bio'

ff = Bio::FlatFile.new(Bio::FastaFormat, ARGF)
ff.each_entry do |f|
  puts "definition : " + f.definition
  puts "nalen      : " + f.nalen.to_s
  puts "naseq      : " + f.naseq
end

In above two scripts, the first arguments of Bio::FlatFile.new are database classes of BioRuby. Please refer to the next section for details.

By using Bio::DB.open class method, you can also write as follows:

#!/usr/bin/env ruby

require 'bio'

ff = Bio::GenBank.open("gbvrl1.seq")
ff.each_entry do |gb|
  definition = "#{gb.accession} #{gb.definition}"
  puts gb.naseq.to_fasta(definition, 60)    
end

(TRANSLATOR'S NOTE: Bio::DB.open have not been used so well.)

Next, we are going to parse the FEATURES which is very complicated, and to get nucleic and amino acid sequences of genes.

#!/usr/bin/env ruby

require 'bio'

ff = Bio::FlatFile.new(Bio::GenBank, ARGF)

# iterates over each entry the file
ff.each_entry do |gb|

  # shows accession and organism
  puts "# #{gb.accession} - #{gb.organism}"

  gb.features.each do |feature|     # iterates over each element in FEATURES
    position = feature.position
    hash = feature.assoc            # changing to hash for simplicity (not so recommended)

    # skips the entry if "/translation=" are not found
    next unless hash['translation']

    # collects gene name and so on.
    gene_info = [
      hash['gene'], hash['product'], hash['note'], hash['function']
    ].compact.join(', ')

    # shows nucleic acid sequence
    puts ">NA splicing('#{position}') : #{gene_info}"
    puts gb.naseq.splicing(position)

    # shows amino acid sequence translated from nucleic acid sequence
    puts ">AA translated by splicing('#{position}').translate"
    puts gb.naseq.splicing(position).translate

    # shows amino acid sequence in the database entry (/translation=)
    puts ">AA original translation"
    puts hash['translation']
  end
end

Bio::Sequence#splicing splices subsequence from nucleic acid sequence according to location information used in GenBank, EMBL and DDBJ. (TRANSLATOR'S NOTE: EMBL and DDBJ should be added in Japanese document.) When translation table is different from 0(universal), or first codon is not "atg" or the protein contain selenocysteine, the two amino acid sequences will differ. Of cource, if there were a bug in BioRuby, the two sequences would be different, too. (TRANSLATOR'S NOTE: Some cases are added when two amino acid sequences are different.)

The Bio::Sequence#splicing method takes not only DDBJ/EMBL/GenBank feature style location text but also Bio::Locations object. For more information about location format and Bio::Locations class, please refer to bio/location.rb.

You can also use the splicing method for amino acid sequences (Bio::Sequence::AA objects).

Databases other than GenBank

In BioRuby, for databases other than GenBank, essence is same as GenBank. Passing text data of a entry to the DatabaseClass.new(), a parsed object is returned.

If you want to get entries from database flatfile, you can also use Bio::FlatFile class as described above. The first argument of the Bio::FlatFile.new is database class name in BioRuby (such as Bio::GenBank, Bio::KEGG::GENES and so on).

ff = Bio::FlatFile.new(Bio::DatabaseClass, ARGF)

It is wonderful that Bio::FlatFile class can automatically recognize database class. You can simply write as follows.

ff = Bio::FlatFile.auto(ARGF)

#!/usr/bin/env ruby

require 'bio'

ff = Bio::FlatFile.auto(ARGF)
ff.each_entry do |entry|
  p entry.entry_id          # identifier of the entry
  p entry.definition        # definition of the entry
  p entry.seq               # sequence data of the entry
end

Methods to extract specific data from database objects are different for every database. Though some popular methods are common, not all methods are inplemented for every database class (Guideline for common methods is partially described in bio/db.rb).

Please refer to document of each database because methods names and details of methods are differnt for each database.

As a principal, when method name is plural form, the method returns some object as an array. For example, some classes have "references" method which return multiple Bio::Referece objects as an Array object. On the other hand, some classes have "reference" method which return single Bio::Reference object.

Sequence homology search by using FASTA program (Bio::Fasta class)

Assume that you have query.pep file which contains a sequence as FASTA format. We are going to do homology search by using FASTA in remote internet site or in your local machine. You can also use the ssearch program instead of fasta when you use them in your local machine.

using FASTA in local machine

Assume that FASTA is already installed (command name is fasta34 and installed directory is described in PATH environment variable). First, you must prepare FASTA-formatted database sequence file target.pep and FASTA-formatted query.pep. (TRANSLATOR'S NOTE: FASTA can be downloaded from ftp://ftp.virginia.edu/pub/fasta/ . I think we should provide sample data to readers.)

#!/usr/bin/env ruby

require 'bio'

# Creates FASTA factory object ("ssearch" instead of "fasta34" can work)
factory = Bio::Fasta.local('fasta34', ARGV.pop)

# Reads FASTA-formatted files (TRANSLATOR'S NOTE: something wrong in Japanese text)
ff = Bio::FlatFile.new(Bio::FastaFormat, ARGF)

# Iterates over each entry. the variable "entry" is a Bio::FastaFormat object.
ff.each do |entry|
  # shows definition line (begins with '>') to the standard error output
  $stderr.puts "Searching ... " + entry.definition

  # executes homology search. Returns Bio::Fasta::Report object.
  report = factory.query(entry)

  # Iterates over each hit
  report.each do |hit|
    # If E-value is smaller than 0.0001
    if hit.evalue < 0.0001
      # shows identifier of query and hit, E-value, start and end positions of homologous region (TRANSLATOR'S NOTE: should I change Japanese document?)
      print "#{hit.query_id} : evalue #{hit.evalue}\t#{hit.target_id} at "
      p hit.lap_at
    end
  end
end

We named above script as f_search.rb. You can execute as follows:

% ./f_search.rb query.pep target.pep > f_search.out

In above script, the variable "factory" is a factory object for executing FASTA many times easily. Instead of using Fasta#query method, Bio::Sequence#fasta method can be used. (TRANSLATOR'S NOTE: Bio::Sequence#fasta are not so frequently used.)

seq = ">test seq\nYQVLEEIGRGSFGSVRKVIHIPTKKLLVRKDIKYGHMNSKE"
seq.fasta(factory)

When you want to add options to FASTA command, you can set it as third argument of Bio::Fasta.local method. For example, setting ktup to 1 and getting top-10 hits:

factory = Bio::Fasta.local('fasta34', 'target.pep', '-b 10')
factory.ktup = 1

Bio::Fasta#query returns Bio::Fasta::Report object. We can get almost all information described in FASTA report text with the Report object. For example, getting information for hits:

report.each do |hit|
  puts hit.evalue           # E-value
  puts hit.sw               # Smith-Waterman score (*)
  puts hit.identity         # % identity
  puts hit.overlap          # length of overlapping region
  puts hit.query_id         # identifier of query sequence
  puts hit.query_def        # definition(comment line) of query sequence
  puts hit.query_len        # length of query sequence
  puts hit.query_seq        # query sequence (TRANSLATOR'S NOTE: sequence of homologous region of query sequence)
  puts hit.target_id        # identifier of hit sequence
  puts hit.target_def       # definition(comment line) of hit sequence
  puts hit.target_len       # length of hit sequence
  puts hit.target_seq       # hit sequence (TRANSLATOR'S NOTE: sequence of homologous region of hit sequence)
  puts hit.query_start      # start position of homologous region in query sequence
  puts hit.query_end        # end position of homologous region in query sequence
  puts hit.target_start     # start posiotion of homologous region in hit(target) sequence
  puts hit.target_end       # end position of homologous region in hit(target) sequence
  puts hit.lap_at           # array of above four numbers
end

Most of above methods are common with Bio::Blast::Report described below. Please refer to document of Bio::Fasta::Report class for FASTA-specific details. (TRANSLATOR'S NOTE: I deleted a sentense because I cannot translate it well and I think it is not needed here.)

If you need original output text of FASTA program you can use "output" method of the factory object after "query" method.

report = factory.query(entry)
puts factory.output

using FASTA in remote internet site

Currently, only GenomeNet (fasta.genome.jp) is supported. For remote site, Bio::Fasta.remote method is used instead of Bio::Fasta.local. When using remote method, databases available are limited. Except that, you can do almost same thing as local method. (TRANSLATOR'S NOTE: changed order of sentences for smooth translation)

Available databases in GenomeNet:

First, you must select datasese from above list. After that, you should determine search program from the type of query sequence and database.

To set program and database and generates factory.

program = 'fasta'
database = 'genes'

factory = Bio::Fasta.remote(program, database)

You can do almost same thing as local execution(e.g. factory.query).

Homology search by using BLAST (Bio::Blast class)

For execution of homology search by using BLAST, like FASTA, both local execution and remote service are supported. Because most of the API is common with Bio::Fasta as far as possible, you can do the same as above scripts with replacing Bio::Fasta to Bio::Blast.

For example, for BLAST version of f_search.rb, all you have to change is:

# creates BLAST factory object
factory = Bio::Blast.local('blastp', ARGV.pop) 

For remote execution of BLAST in GenomeNet, Bio::Blast.remote is used. The paremeter "program" is different from FASTA.

Bio::BLAST uses "-m 7" XML output of BLAST by default when XMLParser or REXML (both of them are XML parser library for Ruby) is installed. When no XML parser library, Bio::BLAST uses "-m 8" tabular deliminated format. In Ruby 1.8.0 or higher version, REXML is bundled with Ruby's distribution and shall already be installed. Because available information is limited with the "-m 8" format, it is strongly recommended to install XMLParser or REXML library when you are using Ruby version 1.6. If both XMLParser and REXML are installed, XMLParser is preferentially used becase it is faster than REXML. (TRANSLATOR'S NOTE: I changed this paragraph due to the change of BioRuby's default and Ruby's major version up.)

As described above, some methods in Bio::Fasta::Report and Bio::Blast::Report (and Bio::Fasta::Report::Hit and Bio::Blast::Report::Hit) are common. There are some BLAST original methods, for example, bit_score and midline, which might be frequently used.

report.each do |hit|
  puts hit.bit_score        # bit score (*)
  puts hit.query_seq        # query sequence (TRANSLATOR'S NOTE: sequence of homologous region of query sequence)
  puts hit.midline          # middle line string of alignment of homologous region (*)
  puts hit.target_seq       # hit sequence (TRANSLATOR'S NOTE: sequence of homologous region of query sequence)

  puts hit.evalue           # E-value
  puts hit.identity         # % identity
  puts hit.overlap          # length of overlapping region
  puts hit.query_id         # identifier of query sequence
  puts hit.query_def        # definition(comment line) of query sequence
  puts hit.query_len        # length of query sequence
  puts hit.target_id        # identifier of hit sequence
  puts hit.target_def       # definition(comment line) of hit sequence
  puts hit.target_len       # length of hit sequence
  puts hit.query_start      # start position of homologous region in query sequence
  puts hit.query_end        # end position of homologous region in query sequence
  puts hit.target_start     # start position of homologous region in hit(target) sequence
  puts hit.target_end       # end position of homologous region in hit(target) sequence
  puts hit.lap_at           # array of above four numbers
end

For simplicity and API compatibility, some information such as score are extracted from first Hsp (TRANSLATOR'S NOTE: abbreviation of High-scoring Segment Pair).

When you want to access full information of BLAST output, you must understand structure of Bio::Blast::Report object. Indeed, Bio::Blast::Report object have following hierarchical structure. (TRANSLATOR'S NOTE: First sentense of the paragraph is changed.)

Please refer to bio/appl/blast.rb and bio/appl/blast/*.rb for details. (TRANSLATOR'S NOTE: Some sentenses are removed because I could not translate well and I think they are not important.)

Parsing existing BLAST output files

When you already have BLAST output files and you want to parse them, you can directly create Bio::Blast::Report objects without Bio::Blast factory object. For the purpose, Bio::Blast.reports method is used. This method supports "-m 7" XML output format. (TRANSLATOR'S NOTE: Now, default "-m 0" output is also supported. In latest BioRuby, Bio::FlatFile supports BLAST default("-m 0") and XML("-m 7") formats.)

#!/usr/bin/env ruby

require 'bio'

# Iterates over each XML result.
# The variable "report" is a Bio::Blast::Report object.
Bio::Blast.reports(ARGF) do |report|
  puts "Hits for " + report.query_def + " against " + report.db
  report.each do |hit|
    print hit.target_id, "\t", hit.evalue, "\n" if hit.evalue < 0.001
  end
end

We named the script as hits_under_0.001.rb. (TRANSLATOR'S NOTE: don't forget chmod +x) To process BLAST output files *.xml, you can do as follows:

% ./hits_under_0.001.rb *.xml

With some version of BLAST or in some OS, BLAST XML output may be wrong and can not be parsed. We recommended to install BLAST 2.2.5 or later, or changing combinations of -D and -m options when you encounter problems.

How to add remote search sites

(TRANSLATOR'S NOTE: This section is for advanced users.)

Though BLAST sequence homology search services are available in NCBI and many internet sites, BioRuby currently only supports GenomeNet. If you want to add other sites, you must write following routines:

In addition, you must write a private class method in Bio::Blast named "exec_XXXXX" to get query sequence and to pass resut to Bio::Blast::Report.new(or Bio::Blast::Default::Report.new). (TRANSLATOR'S NOTE: Added information about "-m 0" and "-m 7".) After that, you can do as follows:

factory = Bio::Blast.remote(program, db, option, 'XXXXX')

When you write above routines, please send to the BioRuby project and they will be included in future version.

Generates reference list using PubMed (Bio::PubMed class)

Below script is an example which seaches PubMed and creates reference list.

#!/usr/bin/env ruby

require 'bio'

ARGV.each do |id|
  entry = Bio::PubMed.query(id)     # searches PubMed and get entry
  medline = Bio::MEDLINE.new(entry) # creates Bio::MEDLINE object from entry text
  reference = medline.reference     # converts into Bio::Reference object
  puts reference.bibtex             # shows BibTeX formatted text
end

We named the script pmfetch.rb.

% ./pmfetch.rb 11024183 10592278 10592173

To give some PubMed ID (PMID) in arguments, the script retrieves informations from NCBI, parses MEDLINE format text, converts into BibTeX format and shows them.

Keyword search is also available.

#!/usr/bin/env ruby

require 'bio'

# Concatinates argument keyword list to a string
keywords = ARGV.join(' ')

# PubMed keyword search
entries = Bio::PubMed.search(keywords)

entries.each do |entry|
  medline = Bio::MEDLINE.new(entry) # creates Bio::MEDLINE object from text
  reference = medline.reference     # converts into Bio::Reference object
  puts reference.bibtex             # shows BibTeX format text
end

We named the script pmsearch.rb.

% ./pmsearch.rb genome bioinformatics

To give keywords in arguments, the script seaches PubMed by given keywords and shows hit bibliography informations as BibTex format.

Now, using NCBI E-Utils is recommended, it is recommended to use Bio::PubMed.esearch and Bio::PubMed.efetch instead of above methods.

#!/usr/bin/env ruby

require 'bio'

keywords = ARGV.join(' ')

options = {
  'maxdate' => '2003/05/31',
  'retmax' => 1000,
}

entries = Bio::PubMed.esearch(keywords, options)

Bio::PubMed.efetch(entries).each do |entry|
  medline = Bio::MEDLINE.new(entry)
  reference = medline.reference
  puts reference.bibtex
end

The script works same as pmsearch.rb. In addition, by using NCBI E-Utils, it is more powerful than pmsearch.rb, for example, you can specify published dates to search and maximum number of hits to show results. Please refer help page of E-Utils for details of options.

Bio::Reference#bibtex method shows reference information as BibTeX format. It also has bibitem method described below. In addition, it has some journal style format such as nature and nar methods (but you can hardly use them in practice because there are no way to show bold and italic fonts in plain text).

If every database parser parsed such as REFERENCE lines and created Bio::Reference object, it would be very useful because you would be able to convert reference object into BibTeX format and so on. (It is difficult to implement such function because there are many exceptions about personal name and so on).

Memo about BibTeX

In this section, we explain simple usage of TeX for the BibTeX format bibliography list collected by above scripts. For example, to save BibTeX format bibliography data to a file named genoinfo.bib.

% ./pmfetch.rb 10592173 >> genoinfo.bib
% ./pmsearch.rb genome bioinformatics >> genoinfo.bib

Next, to prepare TeX file named hoge.tex as follows.

\documentclass{jarticle}
\begin{document}
\bibliographystyle{plain}
foo bar KEGG database~\cite{PMID:10592173} baz hoge fuga.
\bibliography{genoinfo}
\end{document}

Then,

% latex hoge
% bibtex hoge # processes genoinfo.bib
% latex hoge  # creates bibliography list
% latex hoge  # inserts correct bibliography reference

(TRANSLATOR'S NOTE: I changed platex(Japanese localized version of LaTeX) to latex.)

Now, you get hoge.dvi.

Memo for Bio::Reference#bibitem method

When you don't want to create separate .bib file, you can use Bio::Reference#bibitem method instead of Bio::Reference#bibtex. In above pmfetch.rb and pmsearch.rb scripts, change

puts reference.bibtex

to

puts reference.bibitem

Output documents should be bundled in \begin{thebibliography} and \end{thebibliography} as follows:

\documentclass{jarticle}
\begin{document}
foo bar KEGG database~\cite{PMID:10592173} baz hoge fuga.

\begin{thebibliography}{00}

\bibitem{PMID:10592173}
Kanehisa, M., Goto, S.
KEGG: kyoto encyclopedia of genes and genomes.,
{\em Nucleic Acids Res}, 28(1):27--30, 2000.

\end{thebibliography}
\end{document}

We named above file hoge.tex.

% latex hoge   # creates bibliography list
% latex hoge   # inserts corrent bibliography reference

(TRANSLATOR'S NOTE: I changed platex(Japanese localized version of LaTeX) to latex.)

You should execute latex command two times and you get hoge.dvi.

How to use BioRuby sample program

Some sample programs are stored in samples/ directry. Some programs are obsolete. Since samples are not enough, practical and interesting samples are welcome.

to be written...

OBDA

OBDA (Open Bio Database Access) is a standardized method of sequence database access developed by the Open Bioinformatics Foundation. It was created during BioHackathon by BioPerl, BioJava, BioPython, BioRuby and other projects' members in Arizona in January and in Cape Town in February 2002.

Please refer to <URL:http://obda.open-bio.org/> for details. Specification of them are stored on CVS repository at cvs.open-bio.org. (TRANSLATOR'S NOTE: you can get via http from: <URL:http://cvs.open-bio.org/cgi-bin/viewcvs/viewcvs.cgi/obda-specs/?cvsroot=obf-common> )

BioRegistry

You can specify retrieval method and position for every database in configuration files. Priority of configuration files is:

Note that the last configuration refers to www.open-bio.org is used only when all local configulation files are not available. In current BioRuby implementation, all local configulation files are read. For databases who have same names, settings encountered first is used. This means that if you don't like some settings of a database in system global configuration file (/etc/bioinformatics/seqdatabase.ini), you can easily override it by writing settings to ~/.bioinformatics/seqdatabase.ini. (TRANSLATOR'S NOTE: Order of sentenses are drastically changed for smooth translation.)

The syntax of the configuration file is called stanza format.

[DatabaseName]
protocol=ProtocolName
location=ServeName

You can write description like above entry for every database. Database name is a local label for yourself, so you can name it freely and it can differ from the name of actual databases. In specification of BioRegistry, when there are two or more settings for a database of the same name, it is proposed that connection to the database is tried sequentially with the order written in configuration files. However, it have not been implemented in BioRuby.

In addition, for some protocol, you must set additional options other than locations (e.g. user name of MySQL). In BioRegistory specification, available protocols are:

In BioRuby, you can use index-flat, index-berkleydb, biofetch and biosql. (TRANSLATOR'S NOTE: Due to the change of BioRegistry specification, we must change above. In addition, current implementation of BioSQL in BioRuby is not up-to-date.)

Using BioRegistry, first, create Bio::Registry object. It reads configuration files internally.

reg = Bio::Registry.new

# connects to the database "genbank"
serv = reg.get_database('genbank')

# gets entry of the ID
entry = serv.get_by_id('AA2CG')

The variable "serv" is a server object corresponding to the setting written in configuration files. The class of the object is one of Bio::SQL, Bio::Fetch, and so on. Note that Bio::Registry#get_database("name") returns nil if no database named "name" are found. After that, you can use get_by_id method and some specific methods. Please refer to below documents. (TRANSLATOR'S NOTE: should fix Japanese document.)

BioFlat

BioFlat is a mechanism to create index files of flat files and to retrieve entries fast. There are two index types. index-flat is a simple inde performs binary search without external library of Ruby. index-berkeleydb uses Berkeley DB for indexing. For creating index, you can use br_bioflat.rb command bundled with BioRuby. (TRANSLATOR'S NOTE: should change command name in Japanese text.)

% br_bioflat.rb --makeindex database_name [--format data_format] filename...

Data format can be omitted because BioRuby have data format autodetection function. If you really need, you can specify data format as a name of BioRuby database class. (TRANSLATOR'S NOTE: should fix errata in Japanese text.)

To search and retrieve data from database:

% br_bioflat.rb database_name identifier

For example, to create index of GenBank files gbbct*.seq and get entry from the database:

% br_bioflat.rb --makeindex my_bctdb --format GenBank gbbct*.seq
% br_bioflat.rb my_bctdb A16STM262

If you have installed bdb extension module of Ruby (TRANSLATOR'S NOTE: http://raa.ruby-lang.org/project/bdb/ ), you can create and search indexes with Berkeley DB. When creating index, use "--makeindex-bdb" options instead of "--makeindex".

% br_bioflat.rb --makeindex-bdb database_name [--format data_format] filename...

BioFetch

BioFetch is a database retrieval mechanism via CGI. CGI Parameters, options and error codes are standardized. A client accesses to ta server via http and gives database, identifiers and format to retrieve entries.

BioRuby project have BioFetch server in bioruby.org. It uses GenomeNet's DBGET system as a backend. The source code of the server is in sample/ directory. Currently, there are only two BioFetch servers in the world: bioruby.org and EBI.

There are some methods to retrieve entries from BioFetch server.

  1. Using web browser

    http://bioruby.org/cgi-bin/biofetch.rb
  2. Using br_biofetch.rb command

    % br_biofetch.rb db_name entry_id
  3. Directly using Bio::Fetch in script

    serv = Bio::Fetch.new(server_url)
    entry = serv.fetch(db_name, entry_id)
  4. Indirectly using Bio::Fetch via BioRegistry in script

    reg = Bio::Registry.new
    serv = reg.get_database('genbank')
    entry = serv.get_by_id('AA2CG')

If you want to use (4), you should write some settings to seqdatabase.ini. (Note that server URL and database name are set in the configuration file.)

[genbank]
protocol=biofetch
location=http://bioruby.org/cgi-bin/biofetch.rb
biodbname=genbank

Combination of BioFetch, Bio::KEGG::GENES and Bio::AAindex1

Following program is to get bacteriorhodopsin gene (VNG1467G) of the archaea Halobacterium from KEGG GENES database and to get alpha-helix index data (BURA740101) from AAindex (Amino acid indices and similarity matrices) database, and shows helix score for each 15-aa length overlapping window.

#!/usr/bin/env ruby

require 'bio'

entry = Bio::Fetch.query('hal', 'VNG1467G')
aaseq = Bio::KEGG::GENES.new(entry).aaseq

entry = Bio::Fetch.query('aax1', 'BURA740101')
helix = Bio::AAindex1.new(entry).index

position = 1
win_size = 15

aaseq.window_search(win_size) do |subseq|
  score = subseq.total(helix)
  puts [ position, score ].join("\t")
  position += 1
end

The special method Bio::Fetch.query uses preset BioFetch server in bioruby.org. (The server internally get data from GenomeNet. Because the KEGG/GENES database and AAindex database are not available in other BioFetch servers, we used bioruby.org server with Bio::Fetch.query method.)

BioSQL

to be written...

KEGG API

Please refer to KEGG_API.rd.ja (TRANSLATOR'S NOTE: English version: <URL:http://www.genome.jp/kegg/soap/doc/keggapi_manual.html> ) and

APPENDIX

Installing required external library

to be written...

(TRANSLATOR'S NOTE: No additional libraries are needed with Ruby 1.8.1 or later.)